PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA011095-PA
Common NameOsI_10788
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 185aa    MW: 20707 Da    PI: 10.2519
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA011095-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF442.9e-141958544
                      SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
            SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                      +k  r   fskR ++i+ KA+EL +LC++ vav+ +s++ 
  BGIOSGA011095-PA 19 DKKLRDACFSKRHTTIFNKANELAILCGVMVAVVFVSPNA 58
                      6788999******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.9E-11868IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.432857IPR002100Transcription factor, MADS-box
CDDcd002662.61E-17969No hitNo description
SuperFamilySSF554552.75E-15987IPR002100Transcription factor, MADS-box
PfamPF003195.0E-161965IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MVKCRARTTR KKIEIKRGDK KLRDACFSKR HTTIFNKANE LAILCGVMVA VVFVSPNANG  60
RIFSFGYPSV SSVANRFLAN APNNTSVSTS TQSGRDVEIR ELEREERELK EHLQASTDQN  120
KLLREAIAAR DGGQLMLLLQ SDCSELGPKG LVAVVRLWFR NSLVGIGLDR LCWLLQQILF  180
GLDWG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.818351e-94panicle| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651224.12e-64PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLA2XEM71e-135A2XEM7_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA011095-PA1e-134(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2042088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-13AGAMOUS-like 62